DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and C15

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:121 Identity:51/121 - (42%)
Similarity:65/121 - (53%) Gaps:18/121 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    66 PSEGRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVV 130
            |.:.|..|          ||:|.||:||..||.|||:||..|||||.:||..||..|.:.:|||.
  Fly   208 PYQNRTPP----------KRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVK 262

Human   131 TWFQNRRAKLKRD-VEEMRADVASLRALSPEVLCSL---ALPEGAPDPGLCLGPAG 182
            |||||||.|.:|. .||..|:    |..:..::.||   |:.:|...|...||..|
  Fly   263 TWFQNRRTKWRRQTAEEREAE----RQAANRLMLSLQAEAISKGFAPPSAPLGSQG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 6/22 (27%)
Homeodomain 86..142 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 4/10 (40%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 51/121 (42%)
Homeodomain 218..274 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.