DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and bap

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:125 Identity:50/125 - (40%)
Similarity:62/125 - (49%) Gaps:15/125 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    66 PSEGRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVV 130
            |||.....|..|   ..||:| ||.||:..||.||||||..|:||:..||..:|..|.|...||.
  Fly   160 PSESPLSHDGSG---LSRKKR-SRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVK 220

Human   131 TWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPE---------GAPDPGLCLGPA 181
            .||||||.|.||  ::::...|:|...|..|...:.:.|         .||..|..|.||
  Fly   221 IWFQNRRYKTKR--KQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 8/22 (36%)
Homeodomain 86..142 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 4/9 (44%)
bapNP_732637.1 Homeodomain 176..232 CDD:459649 30/56 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.