DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and CG15696

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:48/102 - (47%) Gaps:13/102 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    62 RALQPSEGRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLAN 126
            |||:.:    .|....||      |..|..||.||:..||..:....||:..:.:.||..|.|.|
  Fly    81 RALRQN----APAKRTPG------RLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTN 135

Human   127 AQVVTWFQNRRA---KLKRDVEEMRADVASLRALSPE 160
            .:|..|||||||   :.||:.:|......|..|.|||
  Fly   136 TRVKIWFQNRRARERREKREKDESCDSTFSSNASSPE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 6/25 (24%)
Homeodomain 86..142 CDD:459649 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 18/48 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.