DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and CG18599

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_650701.1 Gene:CG18599 / 42191 FlyBaseID:FBgn0038592 Length:475 Species:Drosophila melanogaster


Alignment Length:59 Identity:27/59 - (45%)
Similarity:35/59 - (59%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    84 KRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKR 142
            |.::.||.||.:|:..||..|..|:|:...||..||..|.|..|||..||||||.|.::
  Fly   315 KNKRVRTIFTPEQLECLEAEFERQQYMVGPERLYLAHTLKLTEAQVKVWFQNRRIKWRK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 1/4 (25%)
Homeodomain 86..142 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
CG18599NP_650701.1 Homeodomain 317..373 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.