DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and Hmx

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster


Alignment Length:150 Identity:50/150 - (33%)
Similarity:69/150 - (46%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    26 PRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPS----------------EGRAGP- 73
            |..|:.|....|..|.:|    |.........|.....|.||                :|..|| 
  Fly   394 PHQPTTPTSSSSSGGGSS----LTHHPHPHLTGSHGGYLLPSSSNESDEEGEEIIEEDDGTDGPS 454

Human    74 DALGPGPFG--RKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNR 136
            |:..|...|  ::::|:||.|:..||.:||..|..::||:.|||.|||..|.|...||..|||||
  Fly   455 DSSSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNR 519

Human   137 RAKLKRDV--EEMRADVASL 154
            |.|.||.:  |...|::|::
  Fly   520 RNKWKRQLAAELEAANMANM 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 10/44 (23%)
Homeodomain 86..142 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
HmxNP_001262674.1 Homeodomain 469..525 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.