DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and abd-A

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:123 Identity:40/123 - (32%)
Similarity:51/123 - (41%) Gaps:33/123 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    61 ARALQPSEGRAG---------------PDALGP-----------GPFGRKRRKSRTAFTAQQVLE 99
            |..:.|..|.||               .|.:|.           ||.|..||:.|..:|..|.||
  Fly   348 ASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLE 412

Human   100 LERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDV-------EEMRAD 150
            ||:.|.|..||....|..:|..|.|...|:..||||||.|||:::       |:.|.|
  Fly   413 LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 11/51 (22%)
Homeodomain 86..142 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
abd-ANP_732176.1 Homeodomain 399..455 CDD:459649 25/55 (45%)
Abdominal-A 456..478 CDD:403567 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.