DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and Antp

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:126 Identity:38/126 - (30%)
Similarity:57/126 - (45%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    24 MVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPSEGRAG-PDALGP---GPFGR- 83
            |:.:....||:.:..||..:|                 .:..|:...:| |..|.|   ..||: 
  Fly   247 MMHQGQGPPQMHQGHPGQHTP-----------------PSQNPNSQSSGMPSPLYPWMRSQFGKC 294

Human    84 -KRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRD 143
             :|::.|..:|..|.||||:.|.|.:||....|..:|..|.|...|:..||||||.|.|::
  Fly   295 QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 8/31 (26%)
Homeodomain 86..142 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 15/75 (20%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.