DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and zen2

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:115 Identity:40/115 - (34%)
Similarity:55/115 - (47%) Gaps:27/115 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    84 KRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMR 148
            |.::|||||::.|::||||.|...||||.:.|..::.||.|...||..||||||.|||:......
  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKG 106

Human   149 ADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD 198
            |    :.||:..:..|                       ..|.|::|.||
  Fly   107 A----IGALTTSIPLS-----------------------SQSSEDLQKDD 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 1/4 (25%)
Homeodomain 86..142 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 3/24 (13%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.