DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and lms

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_611491.2 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:159 Identity:54/159 - (33%)
Similarity:71/159 - (44%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MNSGREPRTPRTLLSIADILAPRMVPRAPSAPQL-----PESGPGPTSPLCALEELTSKTFRGLD 60
            |||....|......||..|||.   |...|:...     .|||.|... |.|....:..|...||
  Fly     1 MNSQSAVRRYPHSFSIEQILAK---PEMRSSTSFEDSVQDESGRGGNC-LGASRASSPATSSCLD 61

Human    61 ARALQPSEGRAGPDAL---GPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRL 122
            ...   .:|::..|..   |.|....::::.||||:|.|:..||..|...|||:.::|..||.:|
  Fly    62 DNM---DDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQL 123

Human   123 GLANAQVVTWFQNRRAKLKR----DVEEM 147
            .|...|:..||||||.|.||    |||.:
  Fly   124 QLTETQIKIWFQNRRTKWKRKYTSDVETL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 4/28 (14%)
Homeodomain 86..142 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
lmsNP_611491.2 Cnd2 33..>106 CDD:450400 21/76 (28%)
Homeodomain 87..143 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.