DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and B-H2

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster


Alignment Length:162 Identity:45/162 - (27%)
Similarity:65/162 - (40%) Gaps:54/162 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    83 RKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVE-- 145
            :|:||:|||||..|:..||:.|..||||:..:|..||.:|.|::.||.||:||||.|.||...  
  Fly   378 KKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVG 442

Human   146 -EMRADVASLRAL-----------------------------------------------SPEVL 162
             |:.|:..:..|.                                               .|.:.
  Fly   443 LELLAEAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHGATPSAIDIYYRQAAAAAAMQKPSLP 507

Human   163 CSLALPEGAPDPGLCL----GPAGPDSRPHLS 190
            .|..:.:.:..||:.|    .|..|.:.|.||
  Fly   508 ASYRMYQSSIPPGMSLPGMPAPPPPGAAPMLS 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 3/5 (60%)
Homeodomain 86..142 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 8/22 (36%)
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.