DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and vnd

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:41 Identity:11/41 - (26%)
Similarity:19/41 - (46%) Gaps:11/41 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   604 FCIPLLLSKHKRVHTGENPYNSQVCSKAFVYPSKLSKHKKV 644
            |.|.:|:|...|.:           :|..::..:|.|:|||
  Fly   327 FVICMLMSSQYRNN-----------AKILIFNVELLKNKKV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89
Homeodomain 86..142 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
vndNP_476786.2 Homeodomain 546..602 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.