DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDS1 and Spf45

DIOPT Version :9

Sequence 1:NP_015000.3 Gene:GDS1 / 854537 SGDID:S000005882 Length:522 Species:Saccharomyces cerevisiae
Sequence 2:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster


Alignment Length:275 Identity:57/275 - (20%)
Similarity:93/275 - (33%) Gaps:94/275 - (34%)


- Green bases have known domain annotations that are detailed below.


Yeast   302 PSMSNNQQQLLTPNSASKSKNNNKKRNYMDEDTNESMTEPKKTKTTKPGKQTKSQSL-SVLSTPK 365
            |...|..::|       |.|:|...:|.......|...:  |.|..|.|:..:.:.. ..:|.| 
  Fly    97 PQRPNEYEKL-------KEKSNGSDKNRAGVSDREDRDD--KEKDRKRGRVGRREFYRDEVSAP- 151

Yeast   366 KGSSASLSTFASSKN-------------------ISPDSSLSHNA------SSNT--YVTAAAAA 403
               :..||.|...:|                   |:|..||...:      ::||  |..::.||
  Fly   152 ---NLKLSGFGHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMSIDSGCEATNTMPYSASSVAA 213

Yeast   404 PRLSKLLPKNGFK-------------------KNSRSSSELAAIHKVISTQTPIESSSES--SQY 447
                |::.|.|||                   |.|:....:  ||:......|:..|..|  ||.
  Fly   214 ----KIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRI--IHEKDVFLPPLALSPPSIGSQI 272

Yeast   448 NSSSS-------SPVNSAAASS--AESLSDINSSQ-------------DNGRESNPSSQESRNEV 490
            .:|.|       ..|::||.|.  ..|:::|..|.             |...|..|..::..|  
  Fly   273 GTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECN-- 335

Yeast   491 TNWMKIVRNGFLTHD 505
            |.:.::  |..:.|:
  Fly   336 TKYGEV--NSVIIHE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDS1NP_015000.3 None
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 9/42 (21%)
RRM_UHM_SPF45 307..402 CDD:241091 7/46 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.