DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and NAM8

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:21/73 - (28%)
Similarity:37/73 - (50%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    11 TVYVSNLPFSLTNNDLYRIF-SKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNK 74
            :::|.:|..::|.:.|:.:| ::|.......|:.|:.|..|||..|:.|.:.|..|.....:...
Yeast   164 SIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGV 228

Human    75 QLFGRVIK 82
            .|.||.||
Yeast   229 FLNGRAIK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 21/73 (29%)
AIR1 <97..123 CDD:331526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023
RRM2_SECp43_like 162..241 CDD:409781 21/73 (29%)
RRM3_NGR1_NAM8_like 312..383 CDD:409782
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.