DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and NAM8

DIOPT Version :10

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:21/73 - (28%)
Similarity:37/73 - (50%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    11 TVYVSNLPFSLTNNDLYRIF-SKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNK 74
            :::|.:|..::|.:.|:.:| ::|.......|:.|:.|..|||..|:.|.:.|..|.....:...
Yeast   164 SIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGV 228

Human    75 QLFGRVIK 82
            .|.||.||
Yeast   229 FLNGRAIK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..84 CDD:409827 21/73 (29%)
PTZ00368 <97..123 CDD:173561
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023
RRM2_SECp43_like 162..241 CDD:409781 21/73 (29%)
RRM3_NGR1_NAM8_like 312..383 CDD:409782
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.