powered by:
Protein Alignment ZCRB1 and NAM8
DIOPT Version :9
Sequence 1: | NP_149105.3 |
Gene: | ZCRB1 / 85437 |
HGNCID: | 29620 |
Length: | 217 |
Species: | Homo sapiens |
Sequence 2: | NP_011954.1 |
Gene: | NAM8 / 856486 |
SGDID: | S000001128 |
Length: | 523 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 37/73 - (50%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Human 11 TVYVSNLPFSLTNNDLYRIF-SKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNK 74
:::|.:|..::|.:.|:.:| ::|.......|:.|:.|..|||..|:.|.:.|..|.....:...
Yeast 164 SIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGV 228
Human 75 QLFGRVIK 82
.|.||.||
Yeast 229 FLNGRAIK 236
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.