DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and PUB1

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:28/119 - (23%)
Similarity:55/119 - (46%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQL 76
            ::|.:|..::.:..|...|..:...:...:|.|..|..|:|..|:.|..:|.|||...::..:.|
Yeast   164 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDL 228

Human    77 FGRVIKASIAI--DNGRAAEFIRRRNYFDKS----KCYECGESGHLSYACPKNM 124
            .||.::.:.|.  ||.....:.:||||.:.:    :.|....:.:::.....||
Yeast   229 NGRPLRINWAAK
RDNNNNNNYQQRRNYGNNNRGGFRQYNSNNNNNMNMGMNMNM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 18/73 (25%)
AIR1 <97..123 CDD:331526 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 2/5 (40%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026
RRM2_PUB1 161..240 CDD:410031 19/75 (25%)
RRM3_PUB1 341..414 CDD:410033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.