DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and NOP13

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_014224.2 Gene:NOP13 / 855547 SGDID:S000005119 Length:403 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:36/142 - (25%)
Similarity:64/142 - (45%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     7 PSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAI 71
            |....::|.||.|.:|::.|.:.|...|.:||:.:...:|:.|.||.|||.|.:::.:.|..:..
Yeast   236 PPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Human    72 NNKQLFGRVIKASIAIDNG-----RAAEFIRRRN--YFD--KSKCYECGESGHLSYACPKNMLGE 127
            :.:::.||.::.....|..     :..|.:.|.|  .||  .:|.|:.....:.|....|.....
Yeast   301 SCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRNNSSSFDISNNKGYDRAGQDNGSKPEYKRSNAN 365

Human   128 REPPKKKEKKKK 139
            |.||.....:.|
Yeast   366 RRPPVDSNNRTK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 21/76 (28%)
AIR1 <97..123 CDD:331526 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 5/20 (25%)
NOP13NP_014224.2 RRM1_Nop13p_fungi 127..217 CDD:409830
RRM2_Nop13p_fungi 241..316 CDD:409831 21/74 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.