Sequence 1: | NP_149105.3 | Gene: | ZCRB1 / 85437 | HGNCID: | 29620 | Length: | 217 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012203.1 | Gene: | SNP1 / 854749 | SGDID: | S000001323 | Length: | 300 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 195 | Identity: | 47/195 - (24%) |
---|---|---|---|
Similarity: | 83/195 - (42%) | Gaps: | 11/195 - (5%) |
- Green bases have known domain annotations that are detailed below.
Human 11 TVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQ 75
Human 76 LFGRVIKASIA---IDNGRAAEFIRRRNYFD--KSKCYECGES---GHLSYACPKNMLGEREPPK 132
Human 133 KKEKKKKKKAPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGVPSTSDD 197
Human 198 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZCRB1 | NP_149105.3 | RRM_ZCRB1 | 9..86 | CDD:240839 | 28/74 (38%) |
AIR1 | <97..123 | CDD:331526 | 5/30 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..217 | 10/78 (13%) | |||
SNP1 | NP_012203.1 | U1snRNP70_N | 6..95 | CDD:403437 | |
RRM_SNP1_like | 89..201 | CDD:410194 | 33/94 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |