DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and SNP1

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:47/195 - (24%)
Similarity:83/195 - (42%) Gaps:11/195 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    11 TVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQ 75
            |:::..||:.|...:|.:.|.|:|::.|:.|:|||.|:||||.|||:|.|..|::...:.|...:
Yeast   108 TIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHR 172

Human    76 LFGRVIKASIA---IDNGRAAEFIRRRNYFD--KSKCYECGES---GHLSYACPKNMLGEREPPK 132
              |..||..|.   |:.||..::.:.|....  ..:.|...:|   |..:.|...|.......|:
Yeast   173 --GIQIKDRICIVDIERGRTVKYFKPRRLGG
GLGGRGYSNRDSRLPGRFASASTSNPAERNYAPR 235

Human   133 KKEKKKKKKAPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGVPSTSDD 197
            ...::....|...:.......::...|..|.|.:.:...|.... .:....:.:.|...|..:.|
Yeast   236 LPRRETSSSAYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSV-YKSRNSRTRESQPAPKEAPD 299

Human   198  197
            Yeast   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 28/74 (38%)
AIR1 <97..123 CDD:331526 5/30 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 10/78 (13%)
SNP1NP_012203.1 U1snRNP70_N 6..95 CDD:403437
RRM_SNP1_like 89..201 CDD:410194 33/94 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.