DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and HRP1

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_014518.1 Gene:HRP1 / 853997 SGDID:S000005483 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:25/83 - (30%)
Similarity:38/83 - (45%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     5 LAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTR 69
            |:.....:::..|.:..|.::|...|.|||.|..:.||||..|.:|:|..|:.|....|.....:
Yeast   154 LSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVK 218

Human    70 AINNKQLFGRVIKASIAI 87
              ....|.|:||....||
Yeast   219 --TQHILDGKVIDPKRAI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 22/76 (29%)
AIR1 <97..123 CDD:331526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
HRP1NP_014518.1 PABP-1234 <144..463 CDD:130689 25/83 (30%)
RRM1_Hrp1p 161..236 CDD:409991 24/76 (32%)
RRM2_Hrp1p 244..321 CDD:409767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.