DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and CG5808

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster


Alignment Length:254 Identity:50/254 - (19%)
Similarity:95/254 - (37%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     5 LAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTR 69
            :||.::.::|..|....|::||..|||.:|.:....:::|:.|..|...||:.|.|:.|.:....
  Fly   235 MAPPENVLFVCKLNPVTTDDDLEIIFSSFGVLKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYF 299

Human    70 AINNKQLFGRVIKASIA---------------------ID--------------NGRA------- 92
            .::|..:..|.|....:                     :|              |||:       
  Fly   300 KMDNVLIDDRRIHVDFSQSVSKVTWRGKGRGIEGDYRKLDFNNLRDDKDHRKPNNGRSRTEDHKE 364

Human    93 ----AEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREPPKKKEKKKKKKAPEPEEEIEEVE 153
                .:|..|.:..::.|..|............|| |..|...|:|::|...::.:.:.|.....
  Fly   365 RNRTEDFRNRMSSAERRKAREQRHQEQSERDVRKN-LQRRTRSKEKDEKSVYRSKKSQNESVREN 428

Human   154 ESEDEGEDPALDSLSQAIA---FQQAKIEEEQKKWKPSS--GVPSTSDDSR-----RPR 202
            .:.:...:....|.|:...   :.:::..||::..:|..  |..|.|.|.:     |||
  Fly   429 SNRERNRNEKRSSRSRDATHRRYSRSRDREERRPSRPRDQLGRRSRSRDQKERRRSRPR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 20/76 (26%)
AIR1 <97..123 CDD:331526 3/25 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 20/93 (22%)
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902
RRM <237..445 CDD:223796 39/208 (19%)
RRM_PPIL4 237..319 CDD:240681 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.