Sequence 1: | NP_149105.3 | Gene: | ZCRB1 / 85437 | HGNCID: | 29620 | Length: | 217 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651291.1 | Gene: | CG5808 / 42957 | FlyBaseID: | FBgn0027617 | Length: | 653 | Species: | Drosophila melanogaster |
Alignment Length: | 254 | Identity: | 50/254 - (19%) |
---|---|---|---|
Similarity: | 95/254 - (37%) | Gaps: | 57/254 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 5 LAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTR 69
Human 70 AINNKQLFGRVIKASIA---------------------ID--------------NGRA------- 92
Human 93 ----AEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREPPKKKEKKKKKKAPEPEEEIEEVE 153
Human 154 ESEDEGEDPALDSLSQAIA---FQQAKIEEEQKKWKPSS--GVPSTSDDSR-----RPR 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZCRB1 | NP_149105.3 | RRM_ZCRB1 | 9..86 | CDD:240839 | 20/76 (26%) |
AIR1 | <97..123 | CDD:331526 | 3/25 (12%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..217 | 20/93 (22%) | |||
CG5808 | NP_651291.1 | cyclophilin_RRM | 4..169 | CDD:238902 | |
RRM | <237..445 | CDD:223796 | 39/208 (19%) | ||
RRM_PPIL4 | 237..319 | CDD:240681 | 21/81 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |