DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and Rox8

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:86 Identity:24/86 - (27%)
Similarity:48/86 - (55%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     6 APSKSTVYVSNLPFSLTNNDL-YRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTR 69
            :|:.:|||....|.::.::|| ::.|.::|.:..|.:.||      ||.:||.|:.|::|.:...
  Fly   217 SPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKD------KGFSFIKFVTKEAAAHAIE 275

Human    70 AINNKQLFGRVIKASIAIDNG 90
            ..:|.::.|.::|.....:||
  Fly   276 HTHNSEVHGNLVKCFWGKENG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 21/77 (27%)
AIR1 <97..123 CDD:331526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 19/62 (31%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799
RRM3_TIA1_like 221..294 CDD:240800 21/78 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.