DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and CG3335

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:220 Identity:46/220 - (20%)
Similarity:83/220 - (37%) Gaps:60/220 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQL 76
            ::..||.::.|..||.::|.::|.||:|.:..||.|||.||...:.::..:.|......::....
  Fly   366 IFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTDF 430

Human    77 FGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREP----PKKKEKK 137
            .||::....:.|             .:|:               ||..|.|.:.    .:||..|
  Fly   431 HGRLLHLLPS
KD-------------IEKN---------------PKEDLDENDASLSFKEKKALK 467

Human   138 KKKKAPEP---------------------EEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEE 181
            .||.|.:|                     :...|.:.::.|.|...|:     .:|..:.::..|
  Fly   468 LKKNAQKPIGWNTLFLGANAVAEILAKQFKTSKERILDTSDGGSSAAV-----RLALGETQVVIE 527

Human   182 QKKWKPSSGVPSTSDDSRRPRIKKS 206
            .|::....||...:.|  .|..|:|
  Fly   528 MKRFLEEEGVRLDAFD--EPAKKRS 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 20/73 (27%)
AIR1 <97..123 CDD:331526 2/25 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217 24/112 (21%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011 20/73 (27%)
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.