DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZCRB1 and Rsf1

DIOPT Version :9

Sequence 1:	NP_149105.3	Gene:	ZCRB1 / 85437	HGNCID:	29620	Length:	217	Species:	Homo sapiens
Sequence 2:	NP_001260318.1	Gene:	Rsf1 / 34370	FlyBaseID:	FBgn0011305	Length:	200	Species:	Drosophila melanogaster

Alignment Length:	139	Identity:	37/139 - (26%)
Similarity:	53/139 - (38%)	Gaps:	37/139 - (26%)

- Green bases have known domain annotations that are detailed below.

Human    12 VYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQL 76
            |||.||...:..:||...|:||||:..|.|     .....|.||:.|..:|.|:.....:|..:|
  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWI-----AFNPPGFAFVEFEHRDDAEKACDILNGSEL 71

Human    77 FGRVIKASIA------------ID-NGRAAEF--------------IRRRNYFDKS-----KCYE 109
            .|..::..|:            :| .||..:|              .|:|.....|     :.|.
  Fly    72 LGSQLRVEISKGRPRQGRRGGPMDRGGRRGDFGRHSITSGGSGGGGFRQRGSSGSSSRHTERGYS 136

Human   110 CGESGHLSY 118
            .|.||..||
  Fly   137 SGRSGASSY 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZCRB1	NP_149105.3	RRM_ZCRB1	9..86	CDD:240839	23/73 (32%)
		AIR1	<97..123	CDD:331526	9/27 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	120..217
Rsf1	NP_001260318.1	RRM_SRSF3_like	11..82	CDD:409808	24/74 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910