powered by:
Protein Alignment ZCRB1 and sab14
DIOPT Version :9
Sequence 1: | NP_149105.3 |
Gene: | ZCRB1 / 85437 |
HGNCID: | 29620 |
Length: | 217 |
Species: | Homo sapiens |
Sequence 2: | NP_595835.2 |
Gene: | sab14 / 2540462 |
PomBaseID: | SPBC29A3.07c |
Length: | 114 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 61 |
Identity: | 17/61 - (27%) |
Similarity: | 38/61 - (62%) |
Gaps: | 6/61 - (9%) |
- Green bases have known domain annotations that are detailed below.
Human 10 STVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRA 70
|.:::.||.|.:|..::|.:|.:||.|.::.: .:|.:::|.||::: ::.|:..||
pombe 12 SILFIKNLSFKITAEEMYDLFGRYGPVRQIRL---GNTVQTRGTAFVVY---ENVQDARRA 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.