DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZCRB1 and rbm-3.1

DIOPT Version :9

Sequence 1:NP_149105.3 Gene:ZCRB1 / 85437 HGNCID:29620 Length:217 Species:Homo sapiens
Sequence 2:NP_493022.1 Gene:rbm-3.1 / 173070 WormBaseID:WBGene00011155 Length:83 Species:Caenorhabditis elegans


Alignment Length:76 Identity:27/76 - (35%)
Similarity:44/76 - (57%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    11 TVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQ 75
            :|||.|.||..|..:|...||..|::..|.|:.|::|.:.:|.|||.|.::.|||.....:|..:
 Worm     6 SVYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMNGAE 70

Human    76 LFGRVIKASIA 86
            ..||.::.::|
 Worm    71 FNGRPLRVNLA 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZCRB1NP_149105.3 RRM_ZCRB1 9..86 CDD:240839 26/74 (35%)
AIR1 <97..123 CDD:331526
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..217
rbm-3.1NP_493022.1 RRM_SF 8..83 CDD:388407 26/74 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.