DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LMO4 and CG5708

DIOPT Version :9

Sequence 1:NP_001356420.1 Gene:LMO4 / 8543 HGNCID:6644 Length:165 Species:Homo sapiens
Sequence 2:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster


Alignment Length:148 Identity:71/148 - (47%)
Similarity:94/148 - (63%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    21 KRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSG 85
            |.|.|||.||:||:||||:|.|||:.||||.||.|.|.::|:||:|:.|:|||:.||..:||.||
  Fly    76 KVCGGCGDKISDRYLLYALDRYWHNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSG 140

Human    86 ACSACGQSIPASELVMRAQGN----------------VYHLKCFTCSTCRNRLVPGDRFHYINGS 134
            .||.||::||.||||.:|...                |:||:||:|:.|.:.|.||||:..:..|
  Fly   141 VCSGCGETIPPSELVAKALTGINNIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGAS 205

Human   135 LFCEHDRPTALINGHLNS 152
            |.||.|. ..|:.|..||
  Fly   206 LVCEQDW-HKLLKGPANS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LMO4NP_001356420.1 LIM1_LMO4 23..77 CDD:188772 32/53 (60%)
LIM2_LMO4 87..141 CDD:188773 27/69 (39%)
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 32/53 (60%)
LIM 142..212 CDD:413332 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7620
eggNOG 1 0.900 - - E33208_3BFEA
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4927
Inparanoid 1 1.050 154 1.000 Inparanoid score I4336
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000888
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109625
Panther 1 1.100 - - O PTHR45787
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.