DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKI7 and eEF1alpha1

DIOPT Version :9

Sequence 1:NP_014719.1 Gene:SKI7 / 854243 SGDID:S000005602 Length:747 Species:Saccharomyces cerevisiae
Sequence 2:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster


Alignment Length:458 Identity:91/458 - (19%)
Similarity:176/458 - (38%) Gaps:133/458 - (29%)


- Green bases have known domain annotations that are detailed below.


Yeast   266 LNLTCLFLGDTNAGKSTLLGHLLYDLNEISMSSMRELQKKSSNLDPSSSNSFKV--ILDNTKTER 328
            :::..:.:|..::||||..|||:|....|...::.:.:|::..:   ...|||.  :||..|.||
  Fly     6 IHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM---GKGSFKYAWVLDKLKAER 67

Yeast   329 ENGFSMFKKVIQVENDLLPPSSTLTLIDTPGSIKYFNKETLNSIL--TFDPEVYVLVIDCNYDSW 391
            |.|.::...:.:.|.    ....:|:||.||     :::.:.:::  |...:..||::......:
  Fly    68 ERGITIDIALWKFET----AKYYVTIIDAPG-----HRDFIKNMITGTSQADCAVLIVAAGTGEF 123

Yeast   392 EKSLDGPNNQIYEILKVISYLNKNSACKKH-----------LIILLNKADLIS--WDKHRLEMIQ 443
            |..                 ::||...::|           ||:.:||.|...  :.:.|.|.|:
  Fly   124 EAG-----------------ISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIK 171

Yeast   444 SELNYVLKENFQWTDAEFQFIPCSGLLGSN-LNKTENITKSK-YKSEFDSINYVPEWYEGPTFFS 506
            .|::..:|: ..:..|...|:|.||..|.| |..:.|:...| :|.|....|     .:|.|...
  Fly   172 KEVSSYIKK-IGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGN-----ADGKTLID 230

Yeast   507 QLYLLV---EHNMNKIETTLEEPF----VGTI----LQSSVLQP----------------IAEIN 544
            .|..::   ......:...|::.:    :||:    :::.||:|                ..|::
  Fly   231 ALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVVFAPANITTEVKSVEMH 295

Yeast   545 YVSLKVLI---NSGY-IQSGQTIEIHTQY-------------EDFHYYGIVSRMKNSKQILETNT 592
            :.:|:..:   |.|: :::....|:...|             .||           :.|::..|.
  Fly   296 HEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKANPPKGAADF-----------TAQVIVLNH 349

Yeast   593 KNNISVGLNP-----------DILEVLVKI-----HNTEDFTKKQFHIRKGDIIIHSRKTNTLSP 641
            ...|:.|..|           ...|:..|:     ..||:..|   .|:.||..|.:     |.|
  Fly   350 PGQIANGYTPVLDCHTAHIACKFAEIKEKVDRRSGKTTEENPK---FIKSGDAAIVN-----LVP 406

Yeast   642 NLP 644
            :.|
  Fly   407 SKP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKI7NP_014719.1 TEF1 261..747 CDD:227581 91/458 (20%)
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 91/458 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5256
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.