DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG6231

DIOPT Version :9

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001262734.1 Gene:CG6231 / 42339 FlyBaseID:FBgn0038720 Length:585 Species:Drosophila melanogaster


Alignment Length:557 Identity:130/557 - (23%)
Similarity:234/557 - (42%) Gaps:71/557 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     6 FEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWS 70
            |:.|....|.|.|:|.::..:..|.||...:||.....:...|.|.|          :|:     
  Fly     3 FDQILAKCGDFNRYQFMILALFGFINIIVSMHYFTQTVISFVPDHWC----------YHD----- 52

Human    71 LEDTGALLSSGQKDYVTVQLQNGEIW---ELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYD 132
                 .|::...|:.       |||:   |...|:|....|    |:..|.|.|   ..:.:||:
  Fly    53 -----KLVNMTYKEI-------GEIYAQFENPSCTRLDDIN----GHNVTVSSK---ACEKWIYN 98

Human   133 QNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGI 197
            .:....:..|:.|.|||..:.|.:.|.||..|.::|::.:|..||::||...|..::...|....
  Fly    99 YDFGYRSMNTELNWVCDSAYKARIGQSLFFIGSVVGTLFYGLLSDKIGRVPALILSNFCGFAGDF 163

Human   198 AAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA-SVHLHSFFAVGTLLVALTG 261
            :..|.....||...||...:.|.....:.::.|:|:|....||.. ::.:..|:.:|.:......
  Fly   164 STIFTKSVATFTLCRFISGLAADTNFYLMYIIVLEYIRPSMRTLGLNMAVGLFYCLGLVFTPWLA 228

Human   262 YLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLS--- 323
            .||..|.:|....|...:..:|..:|:.|:..||::....:.|...:..:||:|   .|::|   
  Fly   229 VLVGHWQIYLACTSLPILLVVLYYFVVQESAQWLVTRNDIDGAIVRLKRVAKFN---GCRVSQAD 290

Human   324 ------------ELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTGSLGFYSF 376
                        |:|..|          :.::..|..:|....:.|.||.::......:|.:.:.
  Fly   291 FDEFRRHCQMTHEMLGGD----------DKKQATLLDMFRTPRMRKNTLILFFKSMVITLCYDAV 345

Human   377 SLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSAL---ACGVVMVIPQK 438
            |.|...:|.:.::...|..:..:|:...:.:..|::||:.:.:.||....|   |.|:.:...|.
  Fly   346 SRNVEGMGISPFIMFSLSALAVLPSSVLLVLLQDRIGRKGMASGSLLVGGLFTAAAGIAIAYQQH 410

Human   439 HY--ILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSI 501
            ::  ||.....:..:|.:..::.....|..||.||.||...|.:..:....||.|||:.:.|.:.
  Fly   411 NHNAILLACLTIAARFGVAISYESGSQYATELIPTCVRGQGVAAVHVAGFAASFLAPYILWLGTF 475

Human   502 WIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEE 538
            :...|.:.:|.:......:.|.|||||.:.|.||.||
  Fly   476 FKAAPSIILGVLFFAGSFVCLLLPETLNRSLPTTIEE 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 124/544 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
CG6231NP_001262734.1 2A0119 11..509 CDD:273328 124/544 (23%)
MFS 125..499 CDD:119392 83/386 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.