DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG17751

DIOPT Version :9

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650816.3 Gene:CG17751 / 42336 FlyBaseID:FBgn0038717 Length:533 Species:Drosophila melanogaster


Alignment Length:589 Identity:138/589 - (23%)
Similarity:236/589 - (40%) Gaps:88/589 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 EGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWSL 71
            :.:.:..|:||.:|.:|..:..:.||...:||.:...:..||.|.|..|                
  Fly     4 QSVLEKCGNFGPYQILLLGLFGYTNIVSSLHYFSQTIISFTPSHRCSRP---------------- 52

Human    72 EDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTW 136
                       :||                   :..:||.|........|||.|.......::.:
  Fly    53 -----------EDY-------------------QPNSTSLLSCSVMQFDKEFKCTSWDFERESNY 87

Human   137 KS-TAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRR---VVLWATSSSMFLFGI 197
            :| |...:|  |||..:...:.|..|..|..|||:.|||.:||:||.   |:...|.:|...|  
  Fly    88 ESITTELEW--VCDDAYKLAVGQSFFFIGSALGSIFFGYLADRIGRLPACVLSTLTGASGDFF-- 148

Human   198 AAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA-SVHLHSFFAVGTLLVALTG 261
             .:|......|...||...:......|:.::.|.|::..:.||:. ::.|..|:.||.::.....
  Fly   149 -TSFVGSLPWFSFTRFISGLFMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYCVGLMISPWIA 212

Human   262 YLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWN--RASSCKLSE 324
            ..|..|..|....|...:..:|....|.|:..|||::|::|:|:|.:..:||:|  :.......|
  Fly   213 IWVTNWRNYLWAASLPALGMLLFPVFLHESAEWLLTKGKFEKAEKSLRGVAKFNGRQVDDSVFDE 277

Human   325 LLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTGS----LGFYSFSLNSVNLGG 385
            .:. ..:..::||     ::..|..|.....|.|.....:|....|    :.|...|.|...:|.
  Fly   278 FIK-HYREKLNNS-----QNKSSDTFMGMLRTPRLRKFTIILLIKSMIITIAFDILSRNVEGVGI 336

Human   386 NEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSAL---ACG--VVMVIPQKHYILGVV 445
            :.:......|...:||...:.:..:|:||:.:...|||..|:   |.|  |..:.|..:.:|...
  Fly   337 SPFKLFSYSGFCYLPAGLTIILFQNKIGRKGMACASLFVGAIITAATGYLVATLDPSDYSVLLGF 401

Human   446 TAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFV 510
            ...:|::....|:.....|.||:.||.|:...|.:..:|....:..:.:.:.|.:.:..:|.|.:
  Fly   402 MVSLGRYGAVVAYDAEAQYAAEIIPTSVKGRGVANIHVVGNAFAFFSSYIIYLGTFYKPLPSLMI 466

Human   511 GTMALLSGVLTLKLPETLGKRLATTWEEA---AKLES-------ENESKSSKLLLTTNNSGLEKT 565
            ..:.|:...|.|.|||||.|.|....||.   ||.|.       ....|:.|     :.:.||.:
  Fly   467 SFILLIGACLCLALPETLHKNLPQNLEEGEMFAKGEKWYFFPCFSRRPKTQK-----SATQLESS 526

Human   566 EAIT 569
            :.||
  Fly   527 DGIT 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 127/536 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577 7/34 (21%)
CG17751NP_650816.3 2A0119 11..490 CDD:273328 127/535 (24%)
MFS 109..481 CDD:119392 90/380 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.