DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG42269

DIOPT Version :9

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster


Alignment Length:555 Identity:149/555 - (26%)
Similarity:256/555 - (46%) Gaps:61/555 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     3 SRHFEGIYDHVGHFGRFQRVLYFICAFQ-NISCGIHYLASVFMGVTP-HHVCRPPGNVSQVVFHN 65
            |..|:.|...:|.|||:|::| |||... :......|.:.:|:.:.| .|.|..|          
  Fly    69 SMDFDDILPLIGEFGRYQKLL-FICMIPFSFFVAFVYFSQIFLTLIPEQHWCHVP---------- 122

Human    66 HSNWSLE--DTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFP---C 125
                .|:  |..|.|:      :::.:.||   |.:.|.......|..|......:..::|   |
  Fly   123 ----ELDGLDVEARLA------LSIPMTNG---EYNNCYMYDVNYTDILAQGKVMADPKWPQVKC 174

Human   126 VDGYIYD-QNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATS 189
            ..|:.|: .....:|..|:.|.|||...|....|.:|..|.::|.:.||:.:||.||...|..|:
  Fly   175 RHGWSYNFTEIPYATVATEQNWVCDDAALPTYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGTN 239

Human   190 SSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTW-ASVHLHSFFAVG 253
            ....|.|:..||..:::.|...|||:.........:.::.|:|::|.|.||: |::.:..||...
  Fly   240 MMGLLAGVGTAFVSNFWEFAIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTGA 304

Human   254 TLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNR-- 316
            ..|:....|.:..|.|..::.|...:..|...:|:||:..||:|:|:.::|..|:..:.|.|.  
  Fly   305 ACLLPWIAYFLADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGNGRQ 369

Human   317 ---------ASSCKLSELLSLDLQGPVSNSPTEVQ--KHNLSYLFYNWSITKRTLTVWLIWFTGS 370
                     ..|||..:             ..|.|  |:::..||.:..:.:.||.:.:||...|
  Fly   370 VPPQTYQIFTDSCKRMQ-------------EQEAQNGKYSVLDLFKSPRLRRTTLLLIVIWMAIS 421

Human   371 LGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVI 435
            |.|.....|..:||.:.:....|....|:||.|.:.:.:|:.|||.:...|:..|.:...:..|:
  Fly   422 LVFDGHVRNVGSLGLDIFFTFTLACFTELPADTLLTVILDRFGRRWLACSSMVLSGVFSLLATVV 486

Human   436 PQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSS 500
            |...|  ....|::|:|.:..::.:...:.||:.||:||:.||....::..:|||:|||.|.|::
  Fly   487 PVGIY--SAALAIMGRFFVNISYNIGLQWAAEVLPTVVRAQAVAFIHIMGYVASIIAPFVVYLAN 549

Human   501 IWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATT 535
            |...:|.:.:|.:.::.|:|.|.|||||...|..|
  Fly   550 ISQALPLIILGILGIIGGLLALLLPETLNHVLPQT 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 145/542 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
CG42269NP_648019.2 2A0119 80..552 CDD:273328 134/510 (26%)
MFS 206..545 CDD:119392 95/353 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.