DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG31272

DIOPT Version :9

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster


Alignment Length:464 Identity:96/464 - (20%)
Similarity:179/464 - (38%) Gaps:115/464 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   164 GVLLGSVTFGYFSDRLGRRVVL-WA-TSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVG 226
            |:.:.::.:||.:|..||:.:| |. ...::.:||  :|.:.::...:..:|...:|.:|...|.
  Fly   107 GMTISAIAWGYLADTKGRKKILYWGYLIDAVCVFG--SALSQNFSMLVMFKFLGGLVVNGPAAVL 169

Human   227 FVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALT----GYLVRTW----W-----LYQMILSTVT 278
            |.|:.|..|.|.|  :||.:.......|..|:|.    |...|.|    |     .:|:.|..:.
  Fly   170 FTYLTEMHGPKHR--SSVLMIVGMVTSTATVSLPLLAWGIFPRDWDFEFWGLQVHSWQIFLFVLG 232

Human   279 VP-----FILCCWVLPETPFWLLSEGRYEEA---------------------------------- 304
            :|     .|.|.  :||:|.:|:::||.|||                                  
  Fly   233 IPSLISGLIFCS--MPESPRFLMAQGRNEEALQAFKQIYHVNTRKPKDSYPIKALIQEVPNRKAA 295

Human   305 --QKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLS-----YLF-YNWSITKRTLT 361
              :.|..|..|.....:.:.|..|:..|:..:......|:|..|.     |:. :...:...|:.
  Fly   296 QNEVIYTIEEKSGEVPTKRQSRTLAESLRAGLQQMKPLVRKPLLGLAICCYVMQFGIFLGMNTIR 360

Human   362 VWLIWFTGSLGFY-----------------SFSLN-----SVN----------LGGNEYLNLFLL 394
            :||.....|:..|                 .||:|     ::|          :..:.|||..::
  Fly   361 LWLPQLFASMAEYEALHAGDGLDVSMCTILEFSVNQTAETALNYADACSEPKVISMDMYLNNIIV 425

Human   395 GVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGVVTA---MVGKFAIGA 456
            .......|.|....:..:|.:.::.|.||.|. ..|:::.......:..:|:|   .:...|:.:
  Fly   426 SATGFVGYFFAGGILRALGPKRMMTYGLFLSG-TFGLMLYFSVSSLMTLIVSATFLTITGIAVSS 489

Human   457 AFGLIYLYTAELYPTIVRSLAVGSGSMVCRL----ASILAPFSVDLSSIWIFIPQLFVGTMALLS 517
            ..|.:    ..|:||.:|::.|....|..|.    .::|.|..|....:   .|.:.|.::.:||
  Fly   490 LLGAV----VALFPTQLRTVVVAIAMMCGRFGALSGNLLFPVFVQTGCL---PPFIMVSSVLILS 547

Human   518 GVLTLKLPE 526
            |:|::.||:
  Fly   548 GILSISLPD 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 96/464 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
CG31272NP_650013.3 MFS 62..555 CDD:119392 94/461 (20%)
2A0115 74..524 CDD:273327 85/427 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.