DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG3168

DIOPT Version :9

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001284957.1 Gene:CG3168 / 31612 FlyBaseID:FBgn0029896 Length:632 Species:Drosophila melanogaster


Alignment Length:466 Identity:104/466 - (22%)
Similarity:177/466 - (37%) Gaps:95/466 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   148 CD-------RKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDY 205
            ||       :.||..:|    ..|:::|:..:|..:|..||:.||...|.......:|::|:..|
  Fly   180 CDLDLNTETKGWLNSII----FIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTY 240

Human   206 YTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLV------ 264
            ..||..||.......|...|.:.|..||.....|......:.:|:..|.|.||...:|:      
  Fly   241 SFFMLFRFLNGAALGGSGPVIWSYFAEFQPKAKRGSMLSFMAAFWTFGNLFVASLAWLIIPRTIG 305

Human   265 --------RTWWLYQMI--LSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASS 319
                    .:|.::.::  |.:..|.|:|  :.|||:|.:||:.|:.:.|..|...:...|  :.
  Fly   306 FTTPYFTYNSWRIFLLVCSLPSFLVGFLL--FYLPESPKFLLTRGKKDRALAIFRGIFVTN--TK 366

Human   320 CKLSELLSLDLQ---------GPVSNSPTEVQKHNL--SYLFYNWSITKRTLTVWLIWFTGSLGF 373
            .:..|.:..||:         |.|.|..:.:....:  |...:...|.:.|:....|.||..:|:
  Fly   367 RRPDEYMVYDLEVDEKLLESNGNVKNKYSRMISGMVDHSRALFKSPILRFTIVSITINFTFHIGY 431

Human   374 Y------------------SFSLNS----------VNLGGNEYLN----------LFLLGVVE-- 398
            |                  :|...|          |||...:..|          :|:..::.  
  Fly   432 YGLLMWFPELFNRFEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLA 496

Human   399 --IPAYTFVCIAMDKVGRRTVLAYSL----FCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAA 457
              :||.....:.||.:||:..|....    .||||...|      :..:..:|.:.:...||.||
  Fly   497 SALPANLLAILGMDMLGRKFFLIAGTMTAGICSALMYFV------RSSVQNLVVSAIFSGAISAA 555

Human   458 FGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSV-DLSSIWIFIPQLFVGTMALLSGVLT 521
            ...:.....|::||.:|:..|....:..||..|:....: .|...:...|...|..:.:..|::.
  Fly   556 NAALDCLITEVFPTKLRATGVAISMVAARLGGIIGNIVIAQLLDNYCPSPTFIVSGLLIGGGLMC 620

Human   522 LKLPETLGKRL 532
            |.||.|..|.|
  Fly   621 LLLPNTTRKEL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 104/466 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
CG3168NP_001284957.1 2A0115 149..598 CDD:273327 94/431 (22%)
MFS 154..623 CDD:119392 99/456 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1933
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.