DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG33234

DIOPT Version :9

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001097483.2 Gene:CG33234 / 2769006 FlyBaseID:FBgn0053234 Length:475 Species:Drosophila melanogaster


Alignment Length:411 Identity:89/411 - (21%)
Similarity:166/411 - (40%) Gaps:84/411 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   149 DRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAAR- 212
            ||: ||.|:...|. ..::....:|..:|..|||.::..||:...:..|.:|...:::.|:..| 
  Fly    53 DRR-LAWLMAASFA-AQMVSCFLWGELADVYGRRKIIMITSTVANIVSILSACVPEFWGFLFLRS 115

Human   213 ---FFLAMVASGYLVVGFVYVMEF--IGMKSRTWASVHLHSFFAVGTLLV---ALTGYL--VRT- 266
               ||:|  ||  :|....|:.||  |.::.|....:.    |::|..::   .|.|.|  :|| 
  Fly   116 VGGFFIA--AS--VVSLMTYLSEFTKISLRPRVLTIMS----FSLGVSMIYVPCLAGVLLPLRTE 172

Human   267 ---WWLYQMILSTVTVPFILCCWV---LPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSEL 325
               |   :::|....||.|:...:   |||:|.:.||....|:|.::::.:.:.|:.....|:.|
  Fly   173 PSSW---RILLLCNQVPGIIGIIILVFLPESPKYYLSINNQEKAMQVMEKICRMNKGKKVTLNSL 234

Human   326 LSLDLQGPVSNSPTEVQKHNLSY------------------LFYNWSITKRTLTVWLI------- 365
            ....|..|....|||  ||...|                  :|::.|.....|.:|::       
  Fly   235 GVESLTQPRLRQPTE--KHGSCYETKVLLLNHAKIMWFFFIIFFSLSGLGFALPIWMLRVRVLTA 297

Human   366 ----WFTGSLGFYSFSLNS-----VNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYS 421
                |.|..........:|     .:|...:..:..:.|.|.:..:....:.:..:.||.|:...
  Fly   298 TFTDWDTMCSHLDGIKADSPGRTECHLTYEQMTDPMIHGCVVLALFVVTSVILTWLSRRWVIIGY 362

Human   422 LFCSALACGVVMVIPQKHYIL----GVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGS 482
            :..|.:.|..:..:...:.||    .::..::....:..:. ||     :|.||.:|.......|
  Fly   363 ICISIIGCVALNFMEHPNLILISFFAIIDPLICSVRLAGSM-LI-----DLVPTHLRGKVFALIS 421

Human   483 MVCRLASILAPFSVDLSSIWI 503
            |..| |.||      ::|:::
  Fly   422 MTGR-AGIL------ITSVYV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 89/411 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
CG33234NP_001097483.2 MFS 56..>198 CDD:119392 38/153 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.