DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APM4 and stnB

DIOPT Version :9

Sequence 1:NP_014579.1 Gene:APM4 / 854092 SGDID:S000005423 Length:491 Species:Saccharomyces cerevisiae
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:333 Identity:70/333 - (21%)
Similarity:123/333 - (36%) Gaps:69/333 - (20%)


- Green bases have known domain annotations that are detailed below.


Yeast   201 RPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSED 265
            |.:.:.:|.:||.:...:.|.:....:|.|||......:.....|:|.|....|:||        
  Fly   898 RERALTYKMEEVQVTAVDEITVEQDFEGKILKQIARVRLFFLAFLTGMPTIELGVND-------- 954

Yeast   266 EKKWLAQQQRHSGSDFGNKNFIPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGS-MELM 329
              .|     |......|..:.||.|....:.||..:||..|:..::.|...|:|.|||.: :||:
  Fly   955 --MW-----RQGKEVVGRHDIIPVATEEWIRLEAVEFHSVVNQKEYERTRTIKFQPPDANYIELL 1012

Yeast   330 KYHVR--DNINLPFKVTPIVTHSTRDNEIDYRITLKSLFPGKLSAK-------DVVLHIPVPPST 385
            ::.||  .|..||.::.  .|.....|:::.|..:  |.||..|.|       ||.:..|:|...
  Fly  1013 RFRVRPPKNRELPLQLK--ATWCVSGNKVELRADI--LVPGFTSRKLGQIPCEDVSVRFPIPECW 1073

Yeast   386 V--------------------------------------DCKISVSNGHCKFVPEENAMIWRFNK 412
            :                                      :..|.|::|..|:.....|::||..:
  Fly  1074 IYLFRVEKHFRYGSVKSAHRRTGKIKGIERILGAVDTLQESLIEVTSGQAKYEHHHRAIVWRCPR 1138

Yeast   413 Y--NGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAV 475
            .  .|....|...:....:.|:...:.....|...:||.:.....|...||..::...|......
  Fly  1139 LPKEGQGAYTTHQLVCRMALTSYDQIPSELAPYAFVEFTMPATQVSHTTVRSVSVQDSDGDEPPE 1203

Yeast   476 KWIKYISK 483
            |:::|:::
  Fly  1204 KYVRYLAR 1211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APM4NP_014579.1 AP2_Mu_N 1..142 CDD:341440
AP-2_Mu2_Cterm 207..490 CDD:271159 69/327 (21%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 70/333 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.