DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ENB1 and CG33282

DIOPT Version :9

Sequence 1:NP_014484.1 Gene:ENB1 / 854007 SGDID:S000005518 Length:606 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:350 Identity:78/350 - (22%)
Similarity:122/350 - (34%) Gaps:96/350 - (27%)


- Green bases have known domain annotations that are detailed below.


Yeast    21 SEKTDSNVEKSTTSGLRRIDAVNKVLSDY--SSFTAFGVTFSSLKTALLVALFLQG--------Y 75
            ||..|||:..:.|| :..:.....:|:.|  |::.|:.|. ..|...|.||.|:..        |
  Fly   138 SEVADSNIRGALTS-MVMLSVDLGILAGYILSTYLAYHVV-PFLAIILPVAYFIANIMLPETAPY 200

Yeast    76 CTGLGGQISQSIQTYAANSFGKH--------SQVGSIN--TVKSIVAS-----VVAVPYARISDR 125
            .      :.:|....|.|||..:        .|...:|  .:::.|.|     ...:.|..::.:
  Fly   201 L------LKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTK 259

Yeast   126 FGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQ---QFG--YSGFRLLATALTGDLSGLRD 185
                                    |...|..|.||:.   ||.  :|....::.......|.:..
  Fly   260 ------------------------PALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDV 300

Yeast   186 RTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPYVYAQYISW 250
            .|..:.|.|:. |:..:.|..:|..|...|.......|.||.||.....|.:..: |..:.: :|
  Fly   301 NTATIIIGLVQ-IVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKI-YDLSDF-NW 362

Yeast   251 RSGKLPPLKLKEKGQTLRQTLWKFADDINLIGVILFTAFLVLV-LLPLTIAGGATSKWREGHIIA 314
            .     ||.|        ..:..:..:|.|||:.    ||||| |.|:.|...|||.   ..|..
  Fly   363 L-----PLVL--------MIIICYVANIGLIGIF----FLVLVELFPVKIRSLATSL---SVIFL 407

Yeast   315 MIVVGGCL----------GFIFLIW 329
            .::|.|.|          |..|.:|
  Fly   408 SLLVFGTLKLFPLMLHYWGISFTMW 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ENB1NP_014484.1 MFS_ARN_like 63..574 CDD:340880 64/305 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 77/349 (22%)
MFS_1 53..409 CDD:284993 72/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.