DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TUL1 and CBLB

DIOPT Version :9

Sequence 1:	NP_012890.1	Gene:	TUL1 / 853832	SGDID:	S000001517	Length:	758	Species:	Saccharomyces cerevisiae
Sequence 2:	NP_001308715.1	Gene:	CBLB / 868	HGNCID:	1542	Length:	1010	Species:	Homo sapiens

Alignment Length:	181	Identity:	45/181 - (24%)
Similarity:	58/181 - (32%)	Gaps:	78/181 - (43%)

- Green bases have known domain annotations that are detailed below.

Yeast   602 PLLWSFVIGTTIIRSLPVVYVFTYSSNVFR---HHKDVHFVVFLSLWLLFQISILYSQDVLGSR- 662
            |..:.|.:..|.:....:.|| |...|:.:   |:|.           |||..|    |  |||
Human   308 PGSYIFRLSCTRLGQWAIGYV-TGDGNILQTIPHNKP-----------LFQALI----D--GSRE 354

Yeast   663 -WFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDVPIYIEEIPETH-KVDQHSY- 724
             ::|    .|||.||...|:                  .:|        |..|..| ||.|..|
Human   355 GFYL----YPDGRSYNPDLT------------------GLC--------EPTPHDHIKVTQEQYE 389

Yeast   725 ----------------------MVTPCNHVFHTSCLENWMNYKLQ-CPVCR 752
                                  .:.||.|:..||||..|.....| ||.||
Human   390 LYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCR 440

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TUL1	NP_012890.1	COG5540	320..758	CDD:227827	45/181 (25%)
CBLB	NP_001308715.1	Cbl_N	72..195	CDD:280432
		Cbl_N2	199..282	CDD:280857
		SH2_Cbl-b_TKB	276..372	CDD:198176	24/103 (23%)
		RING	401..443	CDD:238093	13/40 (33%)
		UBA_Cbl-b	959..999	CDD:270575
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910