DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and rnf24

DIOPT Version :9

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:XP_005160122.1 Gene:rnf24 / 492480 ZFINID:ZDB-GENE-041114-40 Length:157 Species:Danio rerio


Alignment Length:163 Identity:36/163 - (22%)
Similarity:68/163 - (41%) Gaps:44/163 - (26%)


- Green bases have known domain annotations that are detailed below.


Yeast   601 MPLL--------WSFVIGTTIIRSLPVVYVFTYSSNVFRHHKDVHFVVFLSLWLLFQISILYSQD 657
            :|:|        :||.:.....::||:               :::.|||.:...:|.:|:|:...
Zfish     4 LPVLSMTSDLQHYSFRMPNIGFQNLPL---------------NIYIVVFGTAIFVFILSLLFCCY 53

Yeast   658 VLGSRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQH 722
            ::..|....|..    |:|.:.:..|.:.|    ...|.: ||:|       :||..:..::.  
Zfish    54 LIRLRHQAHKEL----YAYKQVIQKEKVKE----LNLHEI-CAVC-------LEEFKQKDELG-- 100

Yeast   723 SYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
               :.||.|.||..||..|:..:..||:|..|:
Zfish   101 ---ICPCKHAFHRKCLIKWLEVRKVCPLCNMPV 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 36/163 (22%)
rnf24XP_005160122.1 zf-RING_2 84..126 CDD:290367 15/54 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I3527
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.