DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and gol

DIOPT Version :9

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:286 Identity:62/286 - (21%)
Similarity:109/286 - (38%) Gaps:63/286 - (22%)


- Green bases have known domain annotations that are detailed below.


Yeast   482 LISIYASQVNEQNVGIINLLRGNTGTYDENRPRPAFIPDEGSIGGSLYGRFFFMLIIFTFLILSS 546
            ||.|.|:.....:......:||..|         |.|||:|....:|..|             ..
  Fly   107 LIHITATDNFSDDYACTPYIRGTLG---------APIPDKGETWIALVRR-------------GR 149

Yeast   547 TSWPRQLRMVFEYIL--IFILNSYWIPQIFRNAVKGIPSRRERA---RSSIGGNRSQNKMPLLWS 606
            .::..:::.|::...  :.|.|...:.|:.:..:|| .:|...|   ..:||.:.|   :.|...
  Fly   150 CTFEEKVKHVYQQNAAGVIIYNDKQVMQLEKMQIKG-KTRNIAAVITYQNIGQDLS---LTLDKG 210

Yeast   607 FVIGTTII---RSLPVVYVFTYSSNVFRHHKDVHFVVFLSL---WLLFQISILYSQDVLGSRWFL 665
            :.:..:||   |.:..:.....:|.:|   ..:.|:|.:.:   ||:|    .|.|..   |:..
  Fly   211 YNVTISIIEGRRGVRTISSLNRTSVLF---VSISFIVLMIISLVWLIF----YYIQRF---RYMQ 265

Yeast   666 PKHTIPDGY-SYFKPLSNEYISEHGGGTAEHTVD---CAICMSDVPIYIEEIPETHKVDQHSYMV 726
            .|....... |..|....:..::.|..:.|..:|   ||||       ||....|..:     .:
  Fly   266 AKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAIC-------IEAYKPTDTI-----RI 318

Yeast   727 TPCNHVFHTSCLENWMNYKLQCPVCR 752
            .||.|.||.:|::.|:.....||:|:
  Fly   319 LPCKHEFHKNCIDPWLIEHRTCPMCK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 62/286 (22%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 26/135 (19%)
UPF0233 226..>258 CDD:299753 7/38 (18%)
zf-RING_2 301..344 CDD:290367 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.