powered by:
Protein Alignment TUL1 and Topors
DIOPT Version :9
Sequence 1: | NP_012890.1 |
Gene: | TUL1 / 853832 |
SGDID: | S000001517 |
Length: | 758 |
Species: | Saccharomyces cerevisiae |
Sequence 2: | NP_001261083.1 |
Gene: | Topors / 37188 |
FlyBaseID: | FBgn0267351 |
Length: | 1038 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 19/67 - (28%) |
Similarity: | 25/67 - (37%) |
Gaps: | 17/67 - (25%) |
- Green bases have known domain annotations that are detailed below.
Yeast 691 GTAEHT---VDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCR 752
||.|.. .:||||:|.. :.......|.|.|...||..|...|.:||:|:
Fly 91 GTVERNSPPPNCAICLSRC--------------RRKCFTDSCMHQFCFKCLCEWSKIKPECPLCK 141
Yeast 753 SP 754
.|
Fly 142 QP 143
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
TUL1 | NP_012890.1 |
COG5540 |
320..758 |
CDD:227827 |
19/67 (28%) |
Topors | NP_001261083.1 |
RING |
102..144 |
CDD:238093 |
16/56 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.