DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and Amfr

DIOPT Version :9

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus


Alignment Length:128 Identity:34/128 - (26%)
Similarity:54/128 - (42%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


Yeast   632 HHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHT 696
            ||  :|.::|.::||.....:::.|  |...:...:..|....:|.:.:.| ..:.....|||..
  Rat   275 HH--IHMLLFGNIWLSMASLVIFMQ--LRYLFHEVQRRIRRHKNYLRVVGN-MEARFAVATAEEL 334

Yeast   697 V----DCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
            .    |||||.       :.:....|:        ||.|:||.|||.:|:.....||.||..|
  Rat   335 AVNNDDCAICW-------DSMQAARKL--------PCGHLFHNSCLRSWLEQDTSCPTCRMSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 34/128 (27%)
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 33/126 (26%)
RING-H2_AMFR 339..382 CDD:319369 19/57 (33%)
CUE_AMFR 458..498 CDD:270604
G2BR 575..600 CDD:375868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.