DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and Rnf6

DIOPT Version :9

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:XP_038945264.1 Gene:Rnf6 / 304271 RGDID:1306092 Length:679 Species:Rattus norvegicus


Alignment Length:57 Identity:20/57 - (35%)
Similarity:31/57 - (54%) Gaps:12/57 - (21%)


- Green bases have known domain annotations that are detailed below.


Yeast   699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
            |::|:||   |:    ..:|:.|     .||.|.||..|::.|::....|||||.|:
  Rat   626 CSVCISD---YV----AGNKLRQ-----LPCLHEFHIHCIDRWLSENCTCPVCRRPV 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 20/57 (35%)
Rnf6XP_038945264.1 RING_Ubox 624..668 CDD:418438 18/53 (34%)
RING-H2 finger (C3H2C3-type) 626..666 CDD:319361 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.