DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TUL1 and Rnf181

DIOPT Version :9

Sequence 1:	NP_012890.1	Gene:	TUL1 / 853832	SGDID:	S000001517	Length:	758	Species:	Saccharomyces cerevisiae
Sequence 2:	NP_001007648.1	Gene:	Rnf181 / 297337	RGDID:	1359698	Length:	165	Species:	Rattus norvegicus

Alignment Length:	58	Identity:	17/58 - (29%)
Similarity:	31/58 - (53%)	Gaps:	12/58 - (20%)

- Green bases have known domain annotations that are detailed below.

Yeast   699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPLP 756
            |.:|:    :..||        :.:.:..||:|:||::|:..|::....||:||..||
  Rat    88 CPVCL----LEFEE--------EETVIEMPCHHLFHSNCILPWLSKTNSCPLCRHELP 133

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TUL1	NP_012890.1	COG5540	320..758	CDD:227827	17/58 (29%)
Rnf181	NP_001007648.1	RING-H2_RNF181	87..132	CDD:319583	15/55 (27%)
Rnf181	NP_001007648.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	136..165
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910