DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and RNF115

DIOPT Version :10

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:NP_055270.1 Gene:RNF115 / 27246 HGNCID:18154 Length:304 Species:Homo sapiens


Alignment Length:59 Identity:20/59 - (33%)
Similarity:29/59 - (49%) Gaps:12/59 - (20%)


- Green bases have known domain annotations that are detailed below.


Yeast   697 VDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
            ::|.:|..|..:. ||:.:           .||||.||:||:..|:.....|||||..|
Human   226 LECPVCKEDYTVE-EEVRQ-----------LPCNHFFHSSCIVPWLELHDTCPVCRKSL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 20/59 (34%)
RNF115NP_055270.1 zinc_ribbon_9 19..49 CDD:433910
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..138
RING-H2_RNF115 226..275 CDD:438452 20/59 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..304 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.