DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and AMFR

DIOPT Version :9

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:NP_001310441.1 Gene:AMFR / 267 HGNCID:463 Length:675 Species:Homo sapiens


Alignment Length:160 Identity:39/160 - (24%)
Similarity:61/160 - (38%) Gaps:50/160 - (31%)


- Green bases have known domain annotations that are detailed below.


Yeast   607 FVIGTTIIRSLPVVYVFTYSSNVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIP 671
            ||:..|:: ||.::           ||  :|.::|.::||.....:::.|    .|:..  |.:.
Human   262 FVMELTLL-SLDLM-----------HH--IHMLLFGNIWLSMASLVIFMQ----LRYLF--HEVQ 306

Yeast   672 DGYSYFKPLSNEYISEHGGGTAEHTV-----------DCAICMSDVPIYIEEIPETHKVDQHSYM 725
            ......|    .|:...|...|...|           |||||.       :.:....|:      
Human   307 RRIRRHK----NYLRVVGNMEARFAVATPEELAVNNDDCAICW-------DSMQAARKL------ 354

Yeast   726 VTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
              ||.|:||.|||.:|:.....||.||..|
Human   355 --PCGHLFHNSCLRSWLEQDTSCPTCRMSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 39/160 (24%)
AMFRNP_001310441.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.