DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TUL1 and mib-1

DIOPT Version :9

Sequence 1:	NP_012890.1	Gene:	TUL1 / 853832	SGDID:	S000001517	Length:	758	Species:	Saccharomyces cerevisiae
Sequence 2:	NP_499452.2	Gene:	mib-1 / 176558	WormBaseID:	WBGene00012933	Length:	765	Species:	Caenorhabditis elegans

Alignment Length:	62	Identity:	18/62 - (29%)
Similarity:	26/62 - (41%)	Gaps:	19/62 - (30%)

- Green bases have known domain annotations that are detailed below.

Yeast   694 EHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
            |...:||||| |:.|.:               |..|.   ||:|::.....|.||.:||..:
Worm   715 ELETNCAICM-DLKIAV---------------VFNCG---HTACVDCADKLKKQCHICRKTI 757

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TUL1	NP_012890.1	COG5540	320..758	CDD:227827	18/62 (29%)
mib-1	NP_499452.2	ANK repeat	242..273	CDD:293786
		Ank_2	247..>313	CDD:289560
		ANK repeat	275..307	CDD:293786
		ANK	341..459	CDD:238125
		ANK repeat	343..379	CDD:293786
		Ank_4	344..402	CDD:290365
		Ank_4	382..436	CDD:290365
		ANK repeat	384..413	CDD:293786
		ANK	410..579	CDD:238125
		ANK repeat	415..446	CDD:293786
		Ank_2	420..>494	CDD:289560
		ANK repeat	448..488	CDD:293786
		ANK repeat	490..557	CDD:293786
		zf-C3HC4_3	611..650	CDD:290631
		zf-C3HC4_3	717..760	CDD:290631	17/60 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910