DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUL1 and H05L14.2

DIOPT Version :9

Sequence 1:NP_012890.1 Gene:TUL1 / 853832 SGDID:S000001517 Length:758 Species:Saccharomyces cerevisiae
Sequence 2:NP_492199.4 Gene:H05L14.2 / 172577 WormBaseID:WBGene00010367 Length:1624 Species:Caenorhabditis elegans


Alignment Length:109 Identity:27/109 - (24%)
Similarity:33/109 - (30%) Gaps:39/109 - (35%)


- Green bases have known domain annotations that are detailed below.


Yeast   647 LFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDVPIYIE 711
            :||.| .|..||:..|                   .|.:.|..|        |.||..    .||
 Worm  1545 MFQCS-GYELDVVTER-------------------EEVVEEEDG--------CLICTE----IIE 1577

Yeast   712 EIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
            |..||...|       .|...:|..|:..|:.....||.|...|
 Worm  1578 EAVETVTCD-------TCTREYHYHCISRWLKINSVCPQCSRAL 1614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUL1NP_012890.1 COG5540 320..758 CDD:227827 27/109 (25%)
H05L14.2NP_492199.4 SMN <351..486 CDD:310529
PAT1 <422..>544 CDD:370676
SMC_prok_A <1285..>1390 CDD:274009
modified RING-H2 finger (C3H2C2D-type) 1569..1610 CDD:319361 15/51 (29%)
zf-RING_2 1569..1610 CDD:372655 15/51 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.