powered by:
Protein Alignment TUL1 and rbx-2
DIOPT Version :9
Sequence 1: | NP_012890.1 |
Gene: | TUL1 / 853832 |
SGDID: | S000001517 |
Length: | 758 |
Species: | Saccharomyces cerevisiae |
Sequence 2: | NP_491849.1 |
Gene: | rbx-2 / 172344 |
WormBaseID: | WBGene00019993 |
Length: | 112 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 18/55 - (32%) |
Similarity: | 27/55 - (49%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Yeast 699 CAICMSDVPIYIEEIPETHKVDQHSYMV-TPCNHVFHTSCLENWMNYKLQCPVCR 752
||||. |.:..|.:....:.....|:| ..|||.||..|:..|:....:||:|:
Worm 50 CAICR--VHLMEECLRCQSEPSAECYVVWGDCNHSFHHCCMTQWIRQNNRCPLCQ 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.