DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TUL1 and LOC100494722

DIOPT Version :9

Sequence 1:	NP_012890.1	Gene:	TUL1 / 853832	SGDID:	S000001517	Length:	758	Species:	Saccharomyces cerevisiae
Sequence 2:	XP_031754530.1	Gene:	LOC100494722 / 100494722	-ID:	-	Length:	596	Species:	Xenopus tropicalis

Alignment Length:	59	Identity:	16/59 - (27%)
Similarity:	30/59 - (50%)	Gaps:	15/59 - (25%)

- Green bases have known domain annotations that are detailed below.

Yeast   697 VDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755
            |:|::|   :.::::.:            .|||.|.|...|||..|:::..||:|:..|
Frog   302 VECSLC---IRMFLDPV------------TTPCGHTFCKECLERCMDHQPYCPLCKQSL 345

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TUL1	NP_012890.1	COG5540	320..758	CDD:227827	16/59 (27%)
LOC100494722	XP_031754530.1	RING_Ubox	6..42	CDD:418438
		PLN03088	88..>160	CDD:215568
		TPR repeat	106..136	CDD:276809
		RING_Ubox	301..342	CDD:418438	14/54 (26%)
		LON_substr_bdg	392..588	CDD:396663
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910