DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICALL1 and Actn3

DIOPT Version :10

Sequence 1:XP_011528773.1 Gene:MICALL1 / 85377 HGNCID:29804 Length:929 Species:Homo sapiens
Sequence 2:NP_524801.1 Gene:Actn3 / 44964 FlyBaseID:FBgn0015008 Length:553 Species:Drosophila melanogaster


Alignment Length:98 Identity:30/98 - (30%)
Similarity:52/98 - (53%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     5 RGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEV 69
            |.:||.||:.:.:.| |:.:.:.|:|:..|.|.|||:|.:.|||:|...|:|....|......:|
  Fly   446 RLSLLRWCQERVKPY-GIPMYEFSASWISGRALCAIIHSYLPDLIDKTYLAKKKPEEVLAYGIKV 509

Human    70 AEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQ 102
            | |.:|:...:|....:....|:...|:.:|.:
  Fly   510 A-KSIGVSDSVDLIRELRQGRPNLEKIVDFVEE 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICALL1XP_011528773.1 CH_MICALL1 4..110 CDD:409101 30/98 (31%)
LIM_Mical_like_1 164..218 CDD:188828
PHA03247 <253..724 CDD:223021
bMERB_dom 744..865 CDD:463467
Actn3NP_524801.1 SMC_N <13..277 CDD:481474
CH_SF 443..540 CDD:469584 29/95 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.