DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPH3 and CG33282

DIOPT Version :9

Sequence 1:NP_012694.1 Gene:MPH3 / 853625 SGDID:S000003921 Length:602 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:472 Identity:93/472 - (19%)
Similarity:177/472 - (37%) Gaps:113/472 - (23%)


- Green bases have known domain annotations that are detailed below.


Yeast   136 DKTGEWEIS---ASW---QIGL-TLCYMAGEIVGLQLTGPSVDLVGNRYTLIIALFFLAAFTFIL 193
            |...::|::   .||   .:|| :||   |.:....|    ::..|.::.|.:.....|....::
  Fly    49 DSPLDFEVNLAQISWLGSMLGLDSLC---GNLTIAML----IERAGRKFCLYLMAGPYACIWILI 106

Yeast   194 YFCNSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSNLCWLFGQLFAAGIMKNS 258
            |..:::..:...:.|||...|....:...:.||:....:|..||:...|....|.|  ||.:.::
  Fly   107 YCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGIL--AGYILST 169

Yeast   259 QKKYADSELGYKLPFALQWILPVPLALGIFFAPESPWWLVKKGRFDEARRSLRRTLSGKGPEKEI 323
            ...|      :.:|| |..||||...:.....||:..:|:||.:...|..|.|...:.:....|.
  Fly   170 YLAY------HVVPF-LAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQ 227

Yeast   324 LVTLEVDKIKVTIDKEKRLTSKEGSYSDCFEDKINRRRTRITCLCWAGQATCGSILIGYSTYFYE 388
            ...:..::::..:..::...:...||.|.           .|.....|.|....:.:||      
  Fly   228 TSKVNFEELRTAVLSQQTRNATPLSYKDL-----------TTKPALKGFAASIVLSLGY------ 275

Yeast   389 KAGVSTEMSFTFSIIQYCLGI-----------CATFLSWWASKYFGRYDLYAFGLAFQTIVFFII 442
                  :.|..||.|.|...|           .||.:       .|...:  .|:...||:..|:
  Fly   276 ------QFSGVFSFINYMSDIFKASGSVVDVNTATII-------IGLVQI--VGVYTSTILVDIV 325

Yeast   443 G------------GLGCSS----THGSKMGSGS--------LLMAVAFFYNLGIAPVVFCLVSEM 483
            |            |:||.:    |:.:|:...|        |::.:.:..|:|:..:.|.::.|:
  Fly   326 GRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVEL 390

Yeast   484 PSSRLRT-----KTIILARNTYNVVSIICSVLILYQLNSKKWNWGAKSG-----FFWGVLCFCTL 538
            ...::|:     ..|.|:...:..:.:...:|..:.::...| :.|.|.     :||        
  Fly   391 FPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMW-FSAASALLTFFYFW-------- 446

Yeast   539 IWAVVDLPETAGKTFVE 555
                :.|.||.||:.:|
  Fly   447 ----LFLQETKGKSMIE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPH3NP_012694.1 SP 72..556 CDD:273317 93/472 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 87/459 (19%)
MFS_1 53..409 CDD:284993 80/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.