DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAMK1 and CG10126

DIOPT Version :9

Sequence 1:XP_005265573.1 Gene:CAMK1 / 8536 HGNCID:1459 Length:413 Species:Homo sapiens
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:45 Identity:15/45 - (33%)
Similarity:21/45 - (46%) Gaps:12/45 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   257 MEKDPEKRFTCEQALQHPWIAG--DTALDKNIHQSVSEQIKKNFA 299
            |:.|..|....|:     :|.|  ||.||.:     .|:||:.||
  Fly    69 MDDDGSKALNEEE-----FITGIRDTGLDVS-----EEEIKQMFA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAMK1XP_005265573.1 STKc_CaMKI_alpha 16..278 CDD:271069 5/20 (25%)
S_TKc 20..276 CDD:214567 4/18 (22%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/45 (33%)
EFh 64..119 CDD:238008 15/45 (33%)
EFh 97..154 CDD:238008 4/7 (57%)
EF-hand_7 98..158 CDD:290234 4/6 (67%)
EF-hand_7 134..204 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.