DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SFC1 and sea

DIOPT Version :9

Sequence 1:NP_012629.1 Gene:SFC1 / 853558 SGDID:S000003856 Length:322 Species:Saccharomyces cerevisiae
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:285 Identity:94/285 - (32%)
Similarity:144/285 - (50%) Gaps:15/285 - (5%)


- Green bases have known domain annotations that are detailed below.


Yeast    14 LMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAV 78
            ::|||..|..|....:|.:.:|.::|:..:.|.   .|..|.....:....:.|||.||:||..:
  Fly    37 IVAGGITGGIEICITYPTEYVKTQLQLDEKGAA---KKYNGIFDCVKKTVGERGFLGLYRGLSVL 98

Yeast    79 VIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQH 143
            |.|.|||.|.||.::||.::..|:.. |.:|.....:.|:|||:.||::.|.|||.:|::     
  Fly    99 VYGSIPKSAARFGAFEFLKSNAVDSR-GQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVK----- 157

Yeast   144 LTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQ 208
            ....:.:..||:....|....|:|.||:|.:|:|::.|..:|.:||...|.|...||:..:....
  Fly   158 FINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDH 222

Yeast   209 MDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFR 273
            ...:|.......|.|:||...|.|.|||.:|||:|     .|| .|..|.......::||.||..
  Fly   223 TKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQ-----GLE-ASKYKNTAHCAVEILKNEGPA 281

Yeast   274 ALYKGITPRVMRVAPGQAVTFTVYE 298
            |.|||..||:.||....|:||.:|:
  Fly   282 AFYKGTVPRLGRVCLDVAITFMIYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SFC1NP_012629.1 Mito_carr 6..103 CDD:395101 29/88 (33%)
Mito_carr 108..206 CDD:395101 30/97 (31%)
Mito_carr 210..304 CDD:395101 34/89 (38%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 91/279 (33%)
Mito_carr 34..117 CDD:278578 28/82 (34%)
Mito_carr 125..220 CDD:278578 31/99 (31%)
Mito_carr 235..314 CDD:278578 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002928
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.